PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 856498
Common NameARALYDRAFT_655942
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 102aa    MW: 12316.8 Da    PI: 10.9269
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
856498genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.84.5e-073877445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T++E++l+ +  ++ G + W++Ia ++  gR ++++  +w 
           856498 38 MTEQEEDLISRMYRLVGDR-WDLIAGRVV-GRKANEIERFWI 77
                     79***************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.8E-43482IPR001005SANT/Myb domain
CDDcd001679.68E-53776No hitNo description
PfamPF002491.9E-63877IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-93977IPR009057Homeodomain-like
SuperFamilySSF466893.59E-63986IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0080147Biological Processroot hair cell development
GO:1900033Biological Processnegative regulation of trichome patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MDNTNRLRRG RSFRQTKFTR SRHDSEEVSS IEWEFISMTE QEEDLISRMY RLVGDRWDLI  60
AGRVVGRKAN EIERFWIMRN SDFFSHKRRH FNNSPFFSSP P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2344111e-105AY234411.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
GenBankAY5195201e-105AY519520.1 Arabidopsis thaliana MYB transcription factor (At2g30420) mRNA, complete cds.
GenBankAY6492551e-105AY649255.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002862821.18e-69predicted protein
SwissprotQ84RD14e-62ETC2_ARATH; MYB-like transcription factor ETC2
TrEMBLD7MWK39e-69D7MWK3_ARALL; Predicted protein
STRINGAl_scaffold_0136_32e-68(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30420.12e-63MYB_related family protein